PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10011349
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 105aa    MW: 11978 Da    PI: 10.8007
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10011349genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF102.21.9e-32959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  Lus10011349  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                 79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.515161IPR002100Transcription factor, MADS-box
CDDcd002659.77E-40261No hitNo description
SuperFamilySSF554553.66E-31263IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.2E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-333859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS  60
SRKLDLGLLY FLPPFYGSKD KLPQSTWRIQ NGQKSKSHNL TGLQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D1e-19261160Myocyte-specific enhancer factor 2A
3mu6_C1e-19261160Myocyte-specific enhancer factor 2A
3mu6_B1e-19261160Myocyte-specific enhancer factor 2A
3mu6_A1e-19261160Myocyte-specific enhancer factor 2A
1tqe_S2e-19161161Myocyte-specific enhancer factor 2B
1tqe_R2e-19161161Myocyte-specific enhancer factor 2B
1tqe_Q2e-19161161Myocyte-specific enhancer factor 2B
1tqe_P2e-19161161Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF7370346e-42JF737034.1 Mangifera indica cultivar SiJi SEPALLATA3-like protein (MSEP3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006385889.17e-38hypothetical protein POPTR_0003s16800g
SwissprotQ034891e-37AGL9_PETHY; Agamous-like MADS-box protein AGL9 homolog
TrEMBLA0A103XKV54e-38A0A103XKV5_CYNCS; Transcription factor, K-box
STRINGPOPTR_0003s16800.12e-37(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.31e-38MIKC_MADS family protein